SCOP 1.69: Domain d1nmub_: 1nmu B:

Lineage for d1nmub_ (1nmu B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)

6. Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55318] (9 PDB entries)

8. Domain d1nmub_: 1nmu B: [80666]
   Other proteins in same PDB: d1nmua_, d1nmuc_

Details for d1nmub_

PDB Entry: 1nmu, 2.31 Å

PDB Description: mbp-l30

SCOP Domain Sequences for d1nmub_:

Sequence; same for both SEQRES and ATOM records:

>d1nmub_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae)}
apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla

Timeline for d1nmub_:

• d1nmub_ first appeared in SCOP 1.63
  
• d1nmub_ appears in SCOP 1.67
  
• d1nmub_ appears in SCOP 1.71
  
• d1nmub_ appears in the current release, SCOPe 2.08