Lineage for d1nmmc_ (1nmm C:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 323287Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 323288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 323297Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 323298Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 323330Species Mouse (Mus musculus) [TaxId:10090] [69628] (8 PDB entries)
  8. 323334Domain d1nmmc_: 1nmm C: [80663]
    Other proteins in same PDB: d1nmmb_, d1nmmd_
    complexed with ca, nag, pg4; mutant

Details for d1nmmc_

PDB Entry: 1nmm (more details), 2 Å

PDB Description: beta-1,4-galactosyltransferase mutant cys342thr complex with alpha- lactalbumin and glcnac

SCOP Domain Sequences for d1nmmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmmc_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus)}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

SCOP Domain Coordinates for d1nmmc_:

Click to download the PDB-style file with coordinates for d1nmmc_.
(The format of our PDB-style files is described here.)

Timeline for d1nmmc_: