Lineage for d1nmdg_ (1nmd G:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870460Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 870461Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 870462Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 870463Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 870480Species Human (Homo sapiens) [TaxId:9606] [55761] (28 PDB entries)
    Uniprot P20065 55-179
  8. 870499Domain d1nmdg_: 1nmd G: [80658]
    Other proteins in same PDB: d1nmda1, d1nmda2
    domain 1
    complexed with atp, ca, so2, so4

Details for d1nmdg_

PDB Entry: 1nmd (more details), 1.9 Å

PDB Description: Crystal Structure of D. Discoideum Actin-Gelsolin Segment 1 Complex Crystallized In Presence Of Lithium ATP
PDB Compounds: (G:) gelsolin

SCOP Domain Sequences for d1nmdg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmdg_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
sgf

SCOP Domain Coordinates for d1nmdg_:

Click to download the PDB-style file with coordinates for d1nmdg_.
(The format of our PDB-style files is described here.)

Timeline for d1nmdg_: