Lineage for d1nmda2 (1nmd A:147-375)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372367Protein Actin [53073] (7 species)
  7. 1372526Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (6 PDB entries)
  8. 1372532Domain d1nmda2: 1nmd A:147-375 [80657]
    Other proteins in same PDB: d1nmdg_
    complexed with atp, ca, so2, so4

Details for d1nmda2

PDB Entry: 1nmd (more details), 1.9 Å

PDB Description: Crystal Structure of D. Discoideum Actin-Gelsolin Segment 1 Complex Crystallized In Presence Of Lithium ATP
PDB Compounds: (A:) actin

SCOPe Domain Sequences for d1nmda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmda2 c.55.1.1 (A:147-375) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaer
eivrdikeklayvaldfeqemataasssaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkcf

SCOPe Domain Coordinates for d1nmda2:

Click to download the PDB-style file with coordinates for d1nmda2.
(The format of our PDB-style files is described here.)

Timeline for d1nmda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nmda1
View in 3D
Domains from other chains:
(mouse over for more information)
d1nmdg_