Lineage for d1nm2a1 (1nm2 A:1-133,A:196-314)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101353Fold c.19: FabD/lysophospholipase-like [52150] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 432156; strand 4 is antiparallel to the rest
  4. 2101354Superfamily c.19.1: FabD/lysophospholipase-like [52151] (3 families) (S)
  5. 2101355Family c.19.1.1: FabD-like [52152] (4 protein domains)
    the superfamily common core covers almost all of the family fold
  6. 2101370Protein Catalytic domain of malonyl-CoA ACP transacylase FabD [52153] (2 species)
  7. 2101373Species Streptomyces coelicolor A3(2) [TaxId:100226] [82463] (1 PDB entry)
  8. 2101374Domain d1nm2a1: 1nm2 A:1-133,A:196-314 [80654]
    Other proteins in same PDB: d1nm2a2, d1nm2a3
    complexed with acy, ni

Details for d1nm2a1

PDB Entry: 1nm2 (more details), 2 Å

PDB Description: "Malonyl-CoA:ACP Transacylase"
PDB Compounds: (A:) malonyl CoA:acyl carrier protein malonyltransferase

SCOPe Domain Sequences for d1nm2a1:

Sequence, based on SEQRES records: (download)

>d1nm2a1 c.19.1.1 (A:1-133,A:196-314) Catalytic domain of malonyl-CoA ACP transacylase FabD {Streptomyces coelicolor A3(2) [TaxId: 100226]}
mlvlvapgqgaqtpgfltdwlalpgaadrvaawsdaigldlahfgtkadadeirdtsvaq
pllvaagilsaaalgtqtsvadatgpgftpgavaghsvgeitaavfagvlddtaalslvr
rrglamaeaaavtXvagafhtrhmapavdklaeaakaltpadpkvtyvsnkdgravasgt
evldrlvgqvanpvrwdlcmetfkelgvtaiievcpggtltglakralpgvktlalktpd
dldaarelvaeht

Sequence, based on observed residues (ATOM records): (download)

>d1nm2a1 c.19.1.1 (A:1-133,A:196-314) Catalytic domain of malonyl-CoA ACP transacylase FabD {Streptomyces coelicolor A3(2) [TaxId: 100226]}
mlvlvapgqgaqtpgfltdwlalpgaadrvaawsdaigldlahfgtkadadeirdtsvaq
pllvaagilsaaalgtgftpgavaghsvgeitaavfagvlddtaalslvrrrglamaeaa
avtXvagafhtrhmapavdklaeaakaltpadpkvtyvsnkdgravasgtevldrlvgqv
anpvrwdlcmetfkelgvtaiievcpggtltglakralpgvktlalktpddldaarelva
eht

SCOPe Domain Coordinates for d1nm2a1:

Click to download the PDB-style file with coordinates for d1nm2a1.
(The format of our PDB-style files is described here.)

Timeline for d1nm2a1: