SCOPe 2.05: Domain d1nm1g_: 1nm1 G:

Lineage for d1nm1g_ (1nm1 G:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)

6. Protein Gelsolin [55759] (2 species)
   consists of six similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (32 PDB entries)
   Uniprot P20065 55-179

8. Domain d1nm1g_: 1nm1 G: [80653]
   Other proteins in same PDB: d1nm1a1, d1nm1a2
   domain 1
   complexed with atp, ca, mg, so2, so4

Details for d1nm1g_

PDB Entry: 1nm1, 1.8 Å

PDB Description: Crystal Structure of D. Dicsoideum Actin Complexed With Gelsolin Segment 1 and Mg ATP at 1.8 A Resolution

PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d1nm1g_:

Sequence; same for both SEQRES and ATOM records:

>d1nm1g_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
sgf

Timeline for d1nm1g_:

• d1nm1g_ first appeared in SCOP 1.63
  
• d1nm1g_ appears in SCOPe 2.04
  
• d1nm1g_ appears in SCOPe 2.06
  
• d1nm1g_ appears in the current release, SCOPe 2.08