Lineage for d1nlxh_ (1nlx H:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1726514Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1727349Superfamily a.24.17: Group V grass pollen allergen [81736] (1 family) (S)
  5. 1727350Family a.24.17.1: Group V grass pollen allergen [81737] (2 proteins)
  6. 1727354Protein Pollen allergen Phl P 6 [81738] (1 species)
  7. 1727355Species Timothy grass (Phleum pratense) [TaxId:15957] [81739] (1 PDB entry)
  8. 1727363Domain d1nlxh_: 1nlx H: [80644]
    complexed with ars, zn

Details for d1nlxh_

PDB Entry: 1nlx (more details), 2.8 Å

PDB Description: crystal structure of phl p 6, a major timothy grass pollen allergen co-crystallized with zinc
PDB Compounds: (H:) Pollen allergen Phl p 6

SCOPe Domain Sequences for d1nlxh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlxh_ a.24.17.1 (H:) Pollen allergen Phl P 6 {Timothy grass (Phleum pratense) [TaxId: 15957]}
atteeqkliedvnasfraamattanvppadkyktfeaaftvsskrnladavskapqlvpk
ldevynaaynaadhaapedkyeafvlhfsealriiagtpevhav

SCOPe Domain Coordinates for d1nlxh_:

Click to download the PDB-style file with coordinates for d1nlxh_.
(The format of our PDB-style files is described here.)

Timeline for d1nlxh_: