Lineage for d1nlxg_ (1nlx G:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211870Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 212165Superfamily a.24.17: Pollen allergen Phl P 6 [81736] (1 family) (S)
  5. 212166Family a.24.17.1: Pollen allergen Phl P 6 [81737] (1 protein)
  6. 212167Protein Pollen allergen Phl P 6 [81738] (1 species)
  7. 212168Species Timothy grass (Phleum pratense) [TaxId:15957] [81739] (1 PDB entry)
  8. 212175Domain d1nlxg_: 1nlx G: [80643]

Details for d1nlxg_

PDB Entry: 1nlx (more details), 2.8 Å

PDB Description: crystal structure of phl p 6, a major timothy grass pollen allergen co-crystallized with zinc

SCOP Domain Sequences for d1nlxg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlxg_ a.24.17.1 (G:) Pollen allergen Phl P 6 {Timothy grass (Phleum pratense)}
atteeqkliedvnasfraamattanvppadkyktfeaaftvsskrnladavskapqlvpk
ldevynaaynaadhaapedkyeafvlhfsealriiagtpevhav

SCOP Domain Coordinates for d1nlxg_:

Click to download the PDB-style file with coordinates for d1nlxg_.
(The format of our PDB-style files is described here.)

Timeline for d1nlxg_: