Lineage for d1nlxf_ (1nlx F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2312192Superfamily a.24.17: Group V grass pollen allergen [81736] (1 family) (S)
  5. 2312193Family a.24.17.1: Group V grass pollen allergen [81737] (2 protein domains)
  6. 2312197Protein Pollen allergen Phl P 6 [81738] (1 species)
  7. 2312198Species Timothy grass (Phleum pratense) [TaxId:15957] [81739] (1 PDB entry)
  8. 2312204Domain d1nlxf_: 1nlx F: [80642]
    complexed with ars, zn

Details for d1nlxf_

PDB Entry: 1nlx (more details), 2.8 Å

PDB Description: Crystal Structure of PHL P 6, A Major Timothy Grass Pollen Allergen Co-Crystallized with Zinc
PDB Compounds: (F:) Pollen allergen Phl p 6

SCOPe Domain Sequences for d1nlxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlxf_ a.24.17.1 (F:) Pollen allergen Phl P 6 {Timothy grass (Phleum pratense) [TaxId: 15957]}
atteeqkliedvnasfraamattanvppadkyktfeaaftvsskrnladavskapqlvpk
ldevynaaynaadhaapedkyeafvlhfsealriiagtpevhav

SCOPe Domain Coordinates for d1nlxf_:

Click to download the PDB-style file with coordinates for d1nlxf_.
(The format of our PDB-style files is described here.)

Timeline for d1nlxf_: