Lineage for d1nlwb_ (1nlw B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537476Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 537477Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family) (S)
    dimer of two identical helix-loop-helix subunits
  5. 537478Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)
  6. 537483Protein Max protein [47461] (2 species)
    BHLHZ region; contains leucine-zipper motif
  7. 537484Species Human (Homo sapiens) [TaxId:9606] [47462] (4 PDB entries)
  8. 537487Domain d1nlwb_: 1nlw B: [80634]
    Other proteins in same PDB: d1nlwa_, d1nlwd_

Details for d1nlwb_

PDB Entry: 1nlw (more details), 2 Å

PDB Description: crystal structure of mad-max recognizing dna

SCOP Domain Sequences for d1nlwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlwb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens)}
krahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqq
diddlkrqnalleqqv

SCOP Domain Coordinates for d1nlwb_:

Click to download the PDB-style file with coordinates for d1nlwb_.
(The format of our PDB-style files is described here.)

Timeline for d1nlwb_: