SCOP 1.63: Domain d1nlbh2: 1nlb H:114-213

Lineage for d1nlbh2 (1nlb H:114-213)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-HCV Fab 19D9D6, (mouse), kappa L chain [81953] (3 PDB entries)

8. Domain d1nlbh2: 1nlb H:114-213 [80622]
   Other proteins in same PDB: d1nlbh1, d1nlbl1

Details for d1nlbh2

PDB Entry: 1nlb, 1.6 Å

PDB Description: crystal structure of anti-HCV monoclonal antibody 19D9D6

SCOP Domain Sequences for d1nlbh2:

Sequence; same for both SEQRES and ATOM records:

>d1nlbh2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Anti-HCV Fab 19D9D6, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d1nlbh2:

• d1nlbh2 is new in SCOP 1.63
  
• d1nlbh2 appears in SCOP 1.65
  
• d1nlbh2 appears in the current release, SCOPe 2.08