Lineage for d1nl4a_ (1nl4 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922275Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 922276Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 922277Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 922324Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (29 PDB entries)
    Uniprot Q04631 55-369
  8. 922372Domain d1nl4a_: 1nl4 A: [80617]
    Other proteins in same PDB: d1nl4b_
    complexed with ftl, hfp, zn

Details for d1nl4a_

PDB Entry: 1nl4 (more details), 2.7 Å

PDB Description: crystal structure of rat farnesyl transferase in complex with a potent biphenyl inhibitor
PDB Compounds: (A:) protein farnesyltransferase alpha subunit

SCOPe Domain Sequences for d1nl4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nl4a_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqsk

SCOPe Domain Coordinates for d1nl4a_:

Click to download the PDB-style file with coordinates for d1nl4a_.
(The format of our PDB-style files is described here.)

Timeline for d1nl4a_: