SCOP 1.69: Domain d1nkws_: 1nkw S:

Lineage for d1nkws_ (1nkw S:)

1. Root: SCOP 1.69

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein 50S subunit [58125] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (15 PDB entries)

8. Domain d1nkws_: 1nkw S: [80604]

Details for d1nkws_

PDB Entry: 1nkw, 3.1 Å

PDB Description: Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans

SCOP Domain Sequences for d1nkws_:

Sequence; same for both SEQRES and ATOM records:

>d1nkws_ i.1.1.2 (S:) 50S subunit {Deinococcus radiodurans}
prpsagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkps
mtnpqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkti

Timeline for d1nkws_:

• d1nkws_ first appeared in SCOP 1.63
  
• d1nkws_ appears in SCOP 1.67
  
• d1nkws_ appears in SCOP 1.71
  
• d1nkws_ appears in the current release, SCOPe 2.08