Lineage for d1nkwi_ (1nkw I:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1971716Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 1971851Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 1971852Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 1971865Domain d1nkwi_: 1nkw I: [80594]
    CA-atoms only for the ribosomal protein structures

Details for d1nkwi_

PDB Entry: 1nkw (more details), 3.1 Å

PDB Description: Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans
PDB Compounds: (I:) 50S ribosomal protein L14

SCOPe Domain Sequences for d1nkwi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkwi_ i.1.1.2 (I:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
impqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaapr
gavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrdr
rfmkivslapev

SCOPe Domain Coordinates for d1nkwi_:

Click to download the PDB-style file with coordinates for d1nkwi_.
(The format of our PDB-style files is described here.)

Timeline for d1nkwi_: