![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.2: Large subunit [58124] (1 protein) |
![]() | Protein 50S subunit [58125] (6 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries) |
![]() | Domain d1nkwd_: 1nkw D: [80589] CA-atoms only for the ribosomal protein structures |
PDB Entry: 1nkw (more details), 3.1 Å
SCOPe Domain Sequences for d1nkwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nkwd_ i.1.1.2 (D:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]} qqlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalit lqkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpna fdgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk
Timeline for d1nkwd_:
![]() Domains from other chains: (mouse over for more information) d1nkw1_, d1nkw2_, d1nkw3_, d1nkw4_, d1nkwa_, d1nkwb_, d1nkwc_, d1nkwe_, d1nkwf_, d1nkwg_, d1nkwh_, d1nkwi_, d1nkwj_, d1nkwk_, d1nkwl_, d1nkwm_, d1nkwn_, d1nkwo_, d1nkwp_, d1nkwq_, d1nkwr_, d1nkws_, d1nkwt_, d1nkwu_, d1nkww_, d1nkwx_, d1nkwy_, d1nkwz_ |