Lineage for d1nkw1_ (1nkw 1:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1070374Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1070375Protein 50S subunit [58125] (6 species)
  7. 1070378Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 1070379Domain d1nkw1_: 1nkw 1: [80581]
    CA-atoms only for the ribosomal protein structures

Details for d1nkw1_

PDB Entry: 1nkw (more details), 3.1 Å

PDB Description: Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans
PDB Compounds: (1:) 50S ribosomal protein L33

SCOPe Domain Sequences for d1nkw1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkw1_ i.1.1.2 (1:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk

SCOPe Domain Coordinates for d1nkw1_:

Click to download the PDB-style file with coordinates for d1nkw1_.
(The format of our PDB-style files is described here.)

Timeline for d1nkw1_: