Lineage for d1nkw1_ (1nkw 1:)
- Root: SCOP 1.67
Class i: Low resolution protein structures [58117] (22 folds) 
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) 
Family i.1.1.2: Large subunit [58124] (3 proteins) Protein 50S subunit [58125] (3 species) Species Deinococcus radiodurans [TaxId:1299] [69993] (14 PDB entries) 
Domain d1nkw1_: 1nkw 1: [80581]
Details for d1nkw1_
PDB Entry: 1nkw (more details), 3.1 Å
PDB Description: Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans
SCOP Domain Sequences for d1nkw1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nkw1_ i.1.1.2 (1:) 50S subunit {Deinococcus radiodurans}
akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk
SCOP Domain Coordinates for d1nkw1_:
Click to download the PDB-style file with coordinates for d1nkw1_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nkw1_:
- d1nkw1_ first appeared in SCOP 1.63
- d1nkw1_ appears in SCOP 1.65
- d1nkw1_ appears in SCOP 1.69
- d1nkw1_ appears in the current release, SCOPe 2.08
 View in 3DDomains from other chains: (mouse over for more information) d1nkw0_, d1nkw2_, d1nkw3_, d1nkw4_, d1nkw9_, d1nkwa_, d1nkwb_, d1nkwc_, d1nkwd_, d1nkwe_, d1nkwf_, d1nkwg_, d1nkwh_, d1nkwi_, d1nkwj_, d1nkwk_, d1nkwl_, d1nkwm_, d1nkwn_, d1nkwo_, d1nkwp_, d1nkwq_, d1nkwr_, d1nkws_, d1nkwt_, d1nkwu_, d1nkww_, d1nkwx_, d1nkwy_, d1nkwz_ |
