Lineage for d1nkva_ (1nkv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129850Family c.66.1.21: Hypothetical Protein YjhP [82469] (2 protein domains)
  6. 2129851Protein Hypothetical Protein YjhP [82470] (1 species)
  7. 2129852Species Escherichia coli [TaxId:562] [82471] (1 PDB entry)
  8. 2129853Domain d1nkva_: 1nkv A: [80577]
    Other proteins in same PDB: d1nkvb2, d1nkvc2
    structural genomics
    CASP5

Details for d1nkva_

PDB Entry: 1nkv (more details), 2.9 Å

PDB Description: x-ray structure of yjhp from e.coli northeast structural genomics research consortium (nesg) target er13
PDB Compounds: (A:) HYPOTHETICAL PROTEIN yjhP

SCOPe Domain Sequences for d1nkva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]}
priftisesehrihnpfteekyatlgrvlrmkpgtrildlgsgsgemlctwardhgitgt
gidmsslftaqakrraeelgvservhfihndaagyvanekcdvaacvgatwiaggfagae
ellaqslkpggimligepywrqlpateeiaqacgvsstsdfltlpglvgafddlgydvve
mvladqegwdryeaakwltmrrwleanpdddfaaevraelniapkryvtyarecfgwgvf
aliar

SCOPe Domain Coordinates for d1nkva_:

Click to download the PDB-style file with coordinates for d1nkva_.
(The format of our PDB-style files is described here.)

Timeline for d1nkva_: