SCOPe 2.01: Domain d1nkpe_: 1nkp E:

Lineage for d1nkpe_ (1nkp E:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.38: HLH-like [47458] (2 superfamilies)
   4-helices; bundle, closed, left-handed twist; 2 crossover connections

4. Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family)
   dimer of two identical helix-loop-helix subunits

5. Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)

6. Protein Max protein [47461] (2 species)
   BHLHZ region; contains leucine-zipper motif

7. Species Human (Homo sapiens) [TaxId:9606] [47462] (4 PDB entries)

8. Domain d1nkpe_: 1nkp E: [80576]
   Other proteins in same PDB: d1nkpa_, d1nkpd_
   complexed with Myc
   protein/DNA complex

Details for d1nkpe_

PDB Entry: 1nkp, 1.8 Å

PDB Description: crystal structure of myc-max recognizing dna

PDB Compounds: (E:) max protein

SCOPe Domain Sequences for d1nkpe_:

Sequence; same for both SEQRES and ATOM records:

>d1nkpe_ a.38.1.1 (E:) Max protein {Human (Homo sapiens) [TaxId: 9606]}
rahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqd
iddlkrqnalleqqvralggc

Timeline for d1nkpe_:

• d1nkpe_ first appeared in SCOP 1.63
  
• d1nkpe_ appears in SCOP 1.75
  
• d1nkpe_ appears in SCOPe 2.02
  
• d1nkpe_ appears in the current release, SCOPe 2.08