![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
![]() | Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family) ![]() dimer of two identical helix-loop-helix subunits |
![]() | Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (7 proteins) |
![]() | Protein Max protein [47461] (2 species) BHLHZ region; contains leucine-zipper motif |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47462] (3 PDB entries) |
![]() | Domain d1nkpe_: 1nkp E: [80576] Other proteins in same PDB: d1nkpa_, d1nkpd_ complexed with Myc |
PDB Entry: 1nkp (more details), 1.8 Å
SCOP Domain Sequences for d1nkpe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nkpe_ a.38.1.1 (E:) Max protein {Human (Homo sapiens)} rahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqd iddlkrqnalleqqvralggc
Timeline for d1nkpe_: