Lineage for d1nkpe_ (1nkp E:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213124Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 213125Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family) (S)
    dimer of two identical helix-loop-helix subunits
  5. 213126Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (7 proteins)
  6. 213131Protein Max protein [47461] (2 species)
    BHLHZ region; contains leucine-zipper motif
  7. 213132Species Human (Homo sapiens) [TaxId:9606] [47462] (3 PDB entries)
  8. 213134Domain d1nkpe_: 1nkp E: [80576]
    Other proteins in same PDB: d1nkpa_, d1nkpd_
    complexed with Myc

Details for d1nkpe_

PDB Entry: 1nkp (more details), 1.8 Å

PDB Description: crystal structure of myc-max recognizing dna

SCOP Domain Sequences for d1nkpe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkpe_ a.38.1.1 (E:) Max protein {Human (Homo sapiens)}
rahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqd
iddlkrqnalleqqvralggc

SCOP Domain Coordinates for d1nkpe_:

Click to download the PDB-style file with coordinates for d1nkpe_.
(The format of our PDB-style files is described here.)

Timeline for d1nkpe_: