Class a: All alpha proteins [46456] (290 folds) |
Fold a.38: HLH-like [47458] (2 superfamilies) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) dimer of two identical helix-loop-helix subunits |
Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (9 proteins) |
Protein Max protein [47461] (2 species) BHLHZ region; contains leucine-zipper motif |
Species Human (Homo sapiens) [TaxId:9606] [47462] (4 PDB entries) |
Domain d1nkpe_: 1nkp E: [80576] Other proteins in same PDB: d1nkpa1, d1nkpa2, d1nkpd1, d1nkpd2 complexed with Myc protein/DNA complex |
PDB Entry: 1nkp (more details), 1.8 Å
SCOPe Domain Sequences for d1nkpe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nkpe_ a.38.1.1 (E:) Max protein {Human (Homo sapiens) [TaxId: 9606]} rahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqd iddlkrqnalleqqvralggc
Timeline for d1nkpe_: