Lineage for d1nkpe_ (1nkp E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319364Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 2319365Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) (S)
    dimer of two identical helix-loop-helix subunits
  5. 2319366Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)
  6. 2319371Protein Max protein [47461] (2 species)
    BHLHZ region; contains leucine-zipper motif
  7. 2319372Species Human (Homo sapiens) [TaxId:9606] [47462] (4 PDB entries)
  8. 2319374Domain d1nkpe_: 1nkp E: [80576]
    Other proteins in same PDB: d1nkpa1, d1nkpa2, d1nkpd1, d1nkpd2
    complexed with Myc
    protein/DNA complex

Details for d1nkpe_

PDB Entry: 1nkp (more details), 1.8 Å

PDB Description: Crystal structure of Myc-Max recognizing DNA
PDB Compounds: (E:) max protein

SCOPe Domain Sequences for d1nkpe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkpe_ a.38.1.1 (E:) Max protein {Human (Homo sapiens) [TaxId: 9606]}
rahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqd
iddlkrqnalleqqvralggc

SCOPe Domain Coordinates for d1nkpe_:

Click to download the PDB-style file with coordinates for d1nkpe_.
(The format of our PDB-style files is described here.)

Timeline for d1nkpe_: