Lineage for d1nkpd1 (1nkp D:500-581)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996289Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 1996290Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) (S)
    dimer of two identical helix-loop-helix subunits
  5. 1996291Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)
  6. 1996308Protein Myc proto-oncogene protein [81750] (1 species)
  7. 1996309Species Human (Homo sapiens) [TaxId:9606] [81751] (1 PDB entry)
    BHLHZ region; contains leucine-zipper motif
  8. 1996311Domain d1nkpd1: 1nkp D:500-581 [80575]
    Other proteins in same PDB: d1nkpa2, d1nkpb_, d1nkpd2, d1nkpe_
    complexed with Max
    protein/DNA complex

Details for d1nkpd1

PDB Entry: 1nkp (more details), 1.8 Å

PDB Description: crystal structure of myc-max recognizing dna
PDB Compounds: (D:) myc proto-oncogene protein

SCOPe Domain Sequences for d1nkpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkpd1 a.38.1.1 (D:500-581) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]}
nvkrrthnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqaeeqk
liseedllrkrreqlkhkleql

SCOPe Domain Coordinates for d1nkpd1:

Click to download the PDB-style file with coordinates for d1nkpd1.
(The format of our PDB-style files is described here.)

Timeline for d1nkpd1: