SCOP 1.65: Domain d1nkpd_: 1nkp D:

Lineage for d1nkpd_ (1nkp D:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily)
   4-helices; bundle, closed, left-handed twist; 2 crossover connections

4. Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family)
   dimer of two identical helix-loop-helix subunits

5. Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (7 proteins)

6. Protein Myc prot-oncogene protein [81750] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81751] (1 PDB entry)
   BHLHZ region; contains leucine-zipper motif

8. Domain d1nkpd_: 1nkp D: [80575]
   Other proteins in same PDB: d1nkpb_, d1nkpe_
   complexed with Max

Details for d1nkpd_

PDB Entry: 1nkp, 1.8 Å

PDB Description: crystal structure of myc-max recognizing dna

SCOP Domain Sequences for d1nkpd_:

Sequence; same for both SEQRES and ATOM records:

>d1nkpd_ a.38.1.1 (D:) Myc prot-oncogene protein {Human (Homo sapiens)}
mnvkrrthnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqaeeq
kliseedllrkrreqlkhkleql

Timeline for d1nkpd_:

• d1nkpd_ first appeared in SCOP 1.63
  
• d1nkpd_ appears in SCOP 1.67
  
• d1nkpd_ appears in the current release, SCOPe 2.08, called d1nkpd1