Lineage for d1nkpd_ (1nkp D:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213124Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 213125Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family) (S)
    dimer of two identical helix-loop-helix subunits
  5. 213126Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (7 proteins)
  6. 213142Protein Myc prot-oncogene protein [81750] (1 species)
  7. 213143Species Human (Homo sapiens) [TaxId:9606] [81751] (1 PDB entry)
    BHLHZ region; contains leucine-zipper motif
  8. 213145Domain d1nkpd_: 1nkp D: [80575]
    Other proteins in same PDB: d1nkpb_, d1nkpe_
    complexed with Max

Details for d1nkpd_

PDB Entry: 1nkp (more details), 1.8 Å

PDB Description: crystal structure of myc-max recognizing dna

SCOP Domain Sequences for d1nkpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkpd_ a.38.1.1 (D:) Myc prot-oncogene protein {Human (Homo sapiens)}
mnvkrrthnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqaeeq
kliseedllrkrreqlkhkleql

SCOP Domain Coordinates for d1nkpd_:

Click to download the PDB-style file with coordinates for d1nkpd_.
(The format of our PDB-style files is described here.)

Timeline for d1nkpd_: