![]() | Class a: All alpha proteins [46456] (171 folds) |
![]() | Fold a.38: Helix-loop-helix DNA-binding domain [47458] (1 superfamily) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
![]() | Superfamily a.38.1: Helix-loop-helix DNA-binding domain [47459] (1 family) ![]() dimer of two identical helix-loop-helix subunits |
![]() | Family a.38.1.1: Helix-loop-helix DNA-binding domain [47460] (7 proteins) |
![]() | Protein Myc prot-oncogene protein [81750] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81751] (1 PDB entry) BHLHZ region; contains leucine-zipper motif |
![]() | Domain d1nkpa_: 1nkp A: [80573] Other proteins in same PDB: d1nkpb_, d1nkpe_ |
PDB Entry: 1nkp (more details), 1.8 Å
SCOP Domain Sequences for d1nkpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nkpa_ a.38.1.1 (A:) Myc prot-oncogene protein {Human (Homo sapiens)} ghmnvkrrthnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqae eqkliseedllrkrreqlkhkleqlggc
Timeline for d1nkpa_: