SCOPe 2.08: Domain d1nkpa1: 1nkp A:900-984

Lineage for d1nkpa1 (1nkp A:900-984)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.38: HLH-like [47458] (2 superfamilies)
   4-helices; bundle, closed, left-handed twist; 2 crossover connections

4. Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families)
   dimer of two identical helix-loop-helix subunits

5. Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (9 proteins)

6. Protein Myc proto-oncogene protein [81750] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81751] (1 PDB entry)
   BHLHZ region; contains leucine-zipper motif

8. Domain d1nkpa1: 1nkp A:900-984 [80573]
   Other proteins in same PDB: d1nkpa2, d1nkpb_, d1nkpd2, d1nkpe_
   complexed with Max
   protein/DNA complex

Details for d1nkpa1

PDB Entry: 1nkp, 1.8 Å

PDB Description: crystal structure of myc-max recognizing dna

PDB Compounds: (A:) myc proto-oncogene protein

SCOPe Domain Sequences for d1nkpa1:

Sequence; same for both SEQRES and ATOM records:

>d1nkpa1 a.38.1.1 (A:900-984) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]}
nvkrrthnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqaeeqk
liseedllrkrreqlkhkleqlggc

Timeline for d1nkpa1:

• d1nkpa1 first appeared in SCOP 1.63, called d1nkpa_
  
• d1nkpa1 appears in SCOPe 2.07