SCOPe 2.07: Domain d1nkhc_: 1nkh C:

Lineage for d1nkhc_ (1nkh C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Mouse (Mus musculus) [TaxId:10090] [69628] (14 PDB entries)

8. Domain d1nkhc_: 1nkh C: [80565]
   Other proteins in same PDB: d1nkhb_, d1nkhd_
   complexed with ca, mn, pg4, so4, udp

Details for d1nkhc_

PDB Entry: 1nkh, 2 Å

PDB Description: Crystal structure of Lactose synthase complex with UDP and Manganese

PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1nkhc_:

Sequence; same for both SEQRES and ATOM records:

>d1nkhc_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

Timeline for d1nkhc_:

• d1nkhc_ first appeared in SCOP 1.63
  
• d1nkhc_ appears in SCOPe 2.06
  
• d1nkhc_ appears in the current release, SCOPe 2.08