Lineage for d1nkhc_ (1nkh C:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 405476Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 405477Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 405486Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 405487Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 405519Species Mouse (Mus musculus) [TaxId:10090] [69628] (9 PDB entries)
  8. 405525Domain d1nkhc_: 1nkh C: [80565]
    Other proteins in same PDB: d1nkhb_, d1nkhd_
    complexed with ca, mn, pg4, so4, udp

Details for d1nkhc_

PDB Entry: 1nkh (more details), 2 Å

PDB Description: Crystal structure of Lactose synthase complex with UDP and Manganese

SCOP Domain Sequences for d1nkhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkhc_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus)}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

SCOP Domain Coordinates for d1nkhc_:

Click to download the PDB-style file with coordinates for d1nkhc_.
(The format of our PDB-style files is described here.)

Timeline for d1nkhc_: