Lineage for d1nkhb_ (1nkh B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1381405Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1381406Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1381415Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 1381416Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 1381417Species Cow (Bos taurus) [TaxId:9913] [53454] (20 PDB entries)
    Uniprot P08037 131-402
  8. 1381427Domain d1nkhb_: 1nkh B: [80564]
    Other proteins in same PDB: d1nkha_, d1nkhc_
    complexed with ca, mn, pg4, so4, udp

Details for d1nkhb_

PDB Entry: 1nkh (more details), 2 Å

PDB Description: Crystal structure of Lactose synthase complex with UDP and Manganese
PDB Compounds: (B:) beta-1,4-galactosyltransferase

SCOPe Domain Sequences for d1nkhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkhb_ c.68.1.2 (B:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}
ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
ywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketm
lsdglnsltymvlevqryplytkitvdigtps

SCOPe Domain Coordinates for d1nkhb_:

Click to download the PDB-style file with coordinates for d1nkhb_.
(The format of our PDB-style files is described here.)

Timeline for d1nkhb_: