![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.57: Herpes virus serine proteinase, assemblin [50788] (1 superfamily) core: barrel, closed; n=7, S=8; complex topology |
![]() | Superfamily b.57.1: Herpes virus serine proteinase, assemblin [50789] (2 families) ![]() automatically mapped to Pfam PF00716 |
![]() | Family b.57.1.1: Herpes virus serine proteinase, assemblin [50790] (5 proteins) |
![]() | Protein Human cytomegalovirus protease [50791] (1 species) |
![]() | Species Human cytomegalovirus [TaxId:10359] [50792] (15 PDB entries) |
![]() | Domain d1njub_: 1nju B: [80560] complexed with 0fp |
PDB Entry: 1nju (more details), 2.7 Å
SCOPe Domain Sequences for d1njub_:
Sequence, based on SEQRES records: (download)
>d1njub_ b.57.1.1 (B:) Human cytomegalovirus protease {Human cytomegalovirus [TaxId: 10359]} deqqsqavapvyvggflarydqspdeaelllprdvvehwlhaqgqgqpslsvalplninh ddtavvghvaamqsvrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkvvef lsgsyaglslssrrcddveqatslsgsettpfkhvalcsvgrrrgtlavygrdpewvtqr fpdltaadrdglraqwqrcgstavdasgdpfrsdsygllgnsvdalyirerlpklrydkq lvgvteresyvka
>d1njub_ b.57.1.1 (B:) Human cytomegalovirus protease {Human cytomegalovirus [TaxId: 10359]} deqqsqavapvyvggflarydqspdeaelllprdvvehwlhaqsvalplninhddtavvg hvaamqsvrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkvveflsgsyag lslssrrcddveqttpfkhvalcsvgrrrgtlavygrdpewvtqrfpdltaadrdglraq wqasgdpfrsdsygllgnsvdalyirerlpklrydkqlvgvteresyvka
Timeline for d1njub_: