Lineage for d1njua_ (1nju A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395155Fold b.57: Herpes virus serine proteinase, assemblin [50788] (1 superfamily)
    core: barrel, closed; n=7, S=8; complex topology
  4. 2395156Superfamily b.57.1: Herpes virus serine proteinase, assemblin [50789] (2 families) (S)
    automatically mapped to Pfam PF00716
  5. 2395157Family b.57.1.1: Herpes virus serine proteinase, assemblin [50790] (5 protein domains)
  6. 2395166Protein Human cytomegalovirus protease [50791] (1 species)
  7. 2395167Species Human cytomegalovirus [TaxId:10359] [50792] (15 PDB entries)
  8. 2395192Domain d1njua_: 1nju A: [80559]
    complexed with 0fp

Details for d1njua_

PDB Entry: 1nju (more details), 2.7 Å

PDB Description: Complex structure of HCMV Protease and a peptidomimetic inhibitor
PDB Compounds: (A:) assemblin

SCOPe Domain Sequences for d1njua_:

Sequence, based on SEQRES records: (download)

>d1njua_ b.57.1.1 (A:) Human cytomegalovirus protease {Human cytomegalovirus [TaxId: 10359]}
deqqsqavapvyvggflarydqspdeaelllprdvvehwlhaqgqgqpslsvalplninh
ddtavvghvaamqsvrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkvvef
lsgsyaglslssrrcddveqatslsgsettpfkhvalcsvgrrrgtlavygrdpewvtqr
fpdltaadrdglraqwqrcgstavdasgdpfrsdsygllgnsvdalyirerlpklrydkq
lvgvteresyvka

Sequence, based on observed residues (ATOM records): (download)

>d1njua_ b.57.1.1 (A:) Human cytomegalovirus protease {Human cytomegalovirus [TaxId: 10359]}
deqqsqavapvyvggflarydqspdeaelllprdvvehwlhaqlsvalplninhddtavv
ghvaamqsvrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkvveflsgsya
glslssrrcddveqttpfkhvalcsvgrrrgtlavygrdpewvtqrfpdltaadrdglra
qwqsgdpfrsdsygllgnsvdalyirerlpklrydkqlvgvteresyvka

SCOPe Domain Coordinates for d1njua_:

Click to download the PDB-style file with coordinates for d1njua_.
(The format of our PDB-style files is described here.)

Timeline for d1njua_: