Lineage for d1njpt_ (1njp T:)

  1. Root: SCOP 1.63
  2. 272796Class i: Low resolution protein structures [58117] (18 folds)
  3. 272797Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 272798Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. Protein 50S subunit [58125] (3 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [69993] (10 PDB entries)
  8. 273099Domain d1njpt_: 1njp T: [80554]
    complexed with a tRNA acceptor stem mimic (asm)

Details for d1njpt_

PDB Entry: 1njp (more details), 3.5 Å

PDB Description: The crystal structure of the 50S Large ribosomal subunit from Deinococcus radiodurans complexed with a tRNA acceptor stem mimic (ASM)

SCOP Domain Sequences for d1njpt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njpt_ i.1.1.2 (T:) 50S subunit {Deinococcus radiodurans}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlpprltaee
leaevqaaqvaglvaagelseeaaeavlegdasleevkaease

SCOP Domain Coordinates for d1njpt_:

Click to download the PDB-style file with coordinates for d1njpt_.
(The format of our PDB-style files is described here.)

Timeline for d1njpt_: