SCOPe 2.06: Domain d1njmt_: 1njm T:

Lineage for d1njmt_ (1njm T:)

1. Root: SCOPe 2.06

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein Prokaryotic (50S subunit) [58125] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1njmt_: 1njm T: [80549]
   complexed with a tRNA acceptor stem mimic (asm) and the antibiotic sparsomycin
   protein/RNA complex; complexed with sps

Details for d1njmt_

PDB Entry: 1njm, 3.6 Å

PDB Description: The crystal structure of the 50S Large ribosomal subunit from Deinococcus radiodurans complexed with a tRNA acceptor stem mimic (ASM) and the antibiotic sparsomycin

PDB Compounds: (T:) general stress protein ctc

SCOPe Domain Sequences for d1njmt_:

Sequence; same for both SEQRES and ATOM records:

>d1njmt_ i.1.1.2 (T:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlpprltaee
leaevqaaqvaglvaagelseeaaeavlegdasleevkaease

Timeline for d1njmt_:

• d1njmt_ first appeared in SCOP 1.63
  
• d1njmt_ appears in SCOPe 2.05
  
• d1njmt_ appears in SCOPe 2.07
  
• d1njmt_ appears in the current release, SCOPe 2.08