SCOPe 2.06: Domain d1nj4a1: 1nj4 A:263-355

Lineage for d1nj4a1 (1nj4 A:263-355)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families)

5. Family b.105.1.1: PBP5 C-terminal domain-like [69190] (2 proteins)
   automatically mapped to Pfam PF07943

6. Protein Penicillin-binding protein 5, C-terminal domain [69191] (1 species)

7. Species Escherichia coli [TaxId:562] [69192] (11 PDB entries)

8. Domain d1nj4a1: 1nj4 A:263-355 [80545]
   Other proteins in same PDB: d1nj4a2
   mutant

Details for d1nj4a1

PDB Entry: 1nj4, 1.9 Å

PDB Description: crystal structure of a deacylation-defective mutant of penicillin- binding protein 5 at 1.9 a resolution

PDB Compounds: (A:) penicillin-binding protein 5

SCOPe Domain Sequences for d1nj4a1:

Sequence; same for both SEQRES and ATOM records:

>d1nj4a1 b.105.1.1 (A:263-355) Penicillin-binding protein 5, C-terminal domain {Escherichia coli [TaxId: 562]}
fetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprgrmkdlkasyvlnsselhap
lqknqvvgtinfqldgktieqrplvvlqeipeg

Timeline for d1nj4a1:

• d1nj4a1 first appeared in SCOP 1.63
  
• d1nj4a1 appears in SCOPe 2.05
  
• d1nj4a1 appears in SCOPe 2.07
  
• d1nj4a1 appears in the current release, SCOPe 2.08