Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1niya_ (1niy A:)

  1. Root: SCOP 1.75B
  2. Class g: Small proteins [56992] (90 folds)
  3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. Family g.3.6.2: Spider toxins [57072] (25 protein domains)
  6. Protein Hainantoxin-IV [82881] (1 species)
  7. Species Spider (Selenocosmia hainana) [TaxId:209901] [82882] (3 PDB entries)
  8. Domain d1niya_: 1niy A: [80542]

Details for d1niya_

PDB Entry: 1niy (more details)
PDB Description: three dimensional solution structure of hainantoxin-iv by 2d 1h-nmr
PDB Compounds: (A:) hainantoxin-IV

SCOP Domain Sequences for d1niya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1niya_ g.3.6.2 (A:) Hainantoxin-IV {Spider (Selenocosmia hainana) [TaxId: 209901]}
eclgfgkgcnpsndqcckssnlvcsrkhrwckyei

SCOP Domain Coordinates for d1niya_:

Click to download the PDB-style file with coordinates for d1niya_.
(The format of our PDB-style files is described here.)

Timeline for d1niya_:

d1niya_ appears in SCOP 1.75A


d1niya_
(click for larger image)

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu