| Class g: Small proteins [56992] (90 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.6: omega toxin-like [57059] (5 families) ![]() |
| Family g.3.6.2: Spider toxins [57072] (25 protein domains) |
| Protein Hainantoxin-IV [82881] (1 species) |
| Species Spider (Selenocosmia hainana) [TaxId:209901] [82882] (3 PDB entries) |
| Domain d1niya_: 1niy A: [80542] |
| PDB Entry: 1niy (more details) PDB Description: three dimensional solution structure of hainantoxin-iv by 2d 1h-nmr
PDB Compounds: (A:) hainantoxin-IVSCOP Domain Sequences for d1niya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1niya_ g.3.6.2 (A:) Hainantoxin-IV {Spider (Selenocosmia hainana) [TaxId: 209901]}
eclgfgkgcnpsndqcckssnlvcsrkhrwckyei
SCOP Domain Coordinates for d1niya_:
Click to download the PDB-style file with coordinates for d1niya_. (The format of our PDB-style files is described here.)
Timeline for d1niya_:
d1niya_ appears in SCOP 1.75A | d1niya_ (click for larger image) |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |