SCOP 1.63: Domain d1ni5a2: 1ni5 A:227-432

Lineage for d1ni5a2 (1ni5 A:227-432)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.229: Putative cell cycle protein MesJ, middle and C-terminal domain [82828] (1 superfamily)
   consists of two different alpha+beta domains

4. Superfamily d.229.1: Putative cell cycle protein MesJ, middle and C-terminal domain [82829] (1 family)

5. Family d.229.1.1: Putative cell cycle protein MesJ, middle and C-terminal domain [82830] (1 protein)

6. Protein Putative cell cycle protein MesJ, middle and C-terminal domain [82831] (1 species)

7. Species Escherichia coli [TaxId:562] [82832] (1 PDB entry)

8. Domain d1ni5a2: 1ni5 A:227-432 [80534]
   Other proteins in same PDB: d1ni5a1
   structural genomics protein; complexed with mse

Details for d1ni5a2

PDB Entry: 1ni5, 2.65 Å

PDB Description: structure of the mesj pp-atpase from escherichia coli

SCOP Domain Sequences for d1ni5a2:

Sequence; same for both SEQRES and ATOM records:

>d1ni5a2 d.229.1.1 (A:227-432) Putative cell cycle protein MesJ, middle and C-terminal domain {Escherichia coli}
laddlahcqspqgtlqivpmlamsdarraaiirrwlagqnapmpsrdalvriwqevalar
edaspclrlgafeirryqsqlwwiksvtgqsenivpwqtwlqplelpaglgsvqlnaggd
irppradeavsvrfkapgllhivgrnggrklkkiwqelgvppwlrdttpllfygetliaa
agvfvtqegvaegengvsfvwqktls

Timeline for d1ni5a2:

• d1ni5a2 is new in SCOP 1.63
  
• d1ni5a2 appears in SCOP 1.65
  
• d1ni5a2 last appears in SCOP 1.69