Lineage for d1ni5a1 (1ni5 A:0-226)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693366Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 693721Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 693912Family c.26.2.5: PP-loop ATPase [82359] (2 proteins)
  6. 693917Protein tRNA-Ile-lysidine synthetase, TilS, N-terminal domain [82360] (1 species)
    formerly putative cell cycle protein MesJ
  7. 693918Species Escherichia coli [TaxId:562] [82361] (1 PDB entry)
  8. 693919Domain d1ni5a1: 1ni5 A:0-226 [80533]
    Other proteins in same PDB: d1ni5a3, d1ni5a4
    complexed with mse

Details for d1ni5a1

PDB Entry: 1ni5 (more details), 2.65 Å

PDB Description: structure of the mesj pp-atpase from escherichia coli
PDB Compounds: (A:) Putative cell cycle protein mesJ

SCOP Domain Sequences for d1ni5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]}
smtltlnrqlltsrqilvafsggldstvllhqlvqwrtenpgvalraihvhhglsanada
wvthcenvcqqwqvplvvervqlaqeglgieaqarqaryqafartllpgevlvtaqhldd
qcetfllalkrgsgpaglsamaevsefagtrlirpllartrgelvqwarqydlrwiedes
nqddsydrnflrlrvvpllqqrwphfaeatarsaalcaeqeslldel

SCOP Domain Coordinates for d1ni5a1:

Click to download the PDB-style file with coordinates for d1ni5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ni5a1: