![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.5: PP-loop ATPase [82359] (2 proteins) automatically mapped to Pfam PF01171 |
![]() | Protein tRNA-Ile-lysidine synthetase, TilS, N-terminal domain [82360] (1 species) formerly putative cell cycle protein MesJ |
![]() | Species Escherichia coli [TaxId:562] [82361] (1 PDB entry) |
![]() | Domain d1ni5a1: 1ni5 A:1-226 [80533] Other proteins in same PDB: d1ni5a3, d1ni5a4, d1ni5a5 |
PDB Entry: 1ni5 (more details), 2.65 Å
SCOPe Domain Sequences for d1ni5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ni5a1 c.26.2.5 (A:1-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} mtltlnrqlltsrqilvafsggldstvllhqlvqwrtenpgvalraihvhhglsanadaw vthcenvcqqwqvplvvervqlaqeglgieaqarqaryqafartllpgevlvtaqhlddq cetfllalkrgsgpaglsamaevsefagtrlirpllartrgelvqwarqydlrwiedesn qddsydrnflrlrvvpllqqrwphfaeatarsaalcaeqeslldel
Timeline for d1ni5a1: