SCOPe 2.08: Domain d1ni5a1: 1ni5 A:1-226

Lineage for d1ni5a1 (1ni5 A:1-226)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.5: PP-loop ATPase [82359] (2 proteins)
   automatically mapped to Pfam PF01171

6. Protein tRNA-Ile-lysidine synthetase, TilS, N-terminal domain [82360] (1 species)
   formerly putative cell cycle protein MesJ

7. Species Escherichia coli [TaxId:562] [82361] (1 PDB entry)

8. Domain d1ni5a1: 1ni5 A:1-226 [80533]
   Other proteins in same PDB: d1ni5a3, d1ni5a4, d1ni5a5

Details for d1ni5a1

PDB Entry: 1ni5, 2.65 Å

PDB Description: structure of the mesj pp-atpase from escherichia coli

PDB Compounds: (A:) Putative cell cycle protein mesJ

SCOPe Domain Sequences for d1ni5a1:

Sequence; same for both SEQRES and ATOM records:

>d1ni5a1 c.26.2.5 (A:1-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]}
mtltlnrqlltsrqilvafsggldstvllhqlvqwrtenpgvalraihvhhglsanadaw
vthcenvcqqwqvplvvervqlaqeglgieaqarqaryqafartllpgevlvtaqhlddq
cetfllalkrgsgpaglsamaevsefagtrlirpllartrgelvqwarqydlrwiedesn
qddsydrnflrlrvvpllqqrwphfaeatarsaalcaeqeslldel

Timeline for d1ni5a1:

• d1ni5a1 first appeared in SCOP 1.63
  
• d1ni5a1 appears in SCOPe 2.07