Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
Protein Ezrin [82142] (1 species) complexed with the icam-2 cytoplasmic peptide, chain B |
Species Human (Homo sapiens) [TaxId:9606] [82143] (1 PDB entry) |
Domain d1ni2b2: 1ni2 B:199-297 [80529] Other proteins in same PDB: d1ni2a1, d1ni2a3, d1ni2b1, d1ni2b3 |
PDB Entry: 1ni2 (more details), 2.3 Å
SCOPe Domain Sequences for d1ni2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ni2b2 b.55.1.5 (B:199-297) Ezrin {Human (Homo sapiens) [TaxId: 9606]} emyginyfeiknkkgtdlwlgvdalglniyekddkltpkigfpwseirnisfndkkfvik pidkkapdfvfyaprlrinkrilqlcmgnhelymrrrkp
Timeline for d1ni2b2: