Lineage for d1ni2b1 (1ni2 B:88-198)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309710Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2309753Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2309754Family a.11.2.1: Second domain of FERM [47032] (9 protein domains)
  6. 2309760Protein Ezrin [81714] (1 species)
  7. 2309761Species Human (Homo sapiens) [TaxId:9606] [81715] (1 PDB entry)
  8. 2309763Domain d1ni2b1: 1ni2 B:88-198 [80528]
    Other proteins in same PDB: d1ni2a2, d1ni2a3, d1ni2b2, d1ni2b3

Details for d1ni2b1

PDB Entry: 1ni2 (more details), 2.3 Å

PDB Description: structure of the active ferm domain of ezrin
PDB Compounds: (B:) Ezrin

SCOPe Domain Sequences for d1ni2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni2b1 a.11.2.1 (B:88-198) Ezrin {Human (Homo sapiens) [TaxId: 9606]}
dvaeeliqditqklfflqvkegilsdeiycppetavllgsyavqakfgdynkevhksgyl
sserlipqrvmdqhkltrdqwedriqvwhaehrgmlkdnamleylkiaqdl

SCOPe Domain Coordinates for d1ni2b1:

Click to download the PDB-style file with coordinates for d1ni2b1.
(The format of our PDB-style files is described here.)

Timeline for d1ni2b1: