Lineage for d1ni2a2 (1ni2 A:199-297)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378166Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 378167Superfamily b.55.1: PH domain-like [50729] (8 families) (S)
  5. 378331Family b.55.1.5: Third domain of FERM [50776] (6 proteins)
  6. 378337Protein Ezrin [82142] (1 species)
    complexed with the icam-2 cytoplasmic peptide, chain B
  7. 378338Species Human (Homo sapiens) [TaxId:9606] [82143] (1 PDB entry)
  8. 378339Domain d1ni2a2: 1ni2 A:199-297 [80526]
    Other proteins in same PDB: d1ni2a1, d1ni2a3, d1ni2b1, d1ni2b3

Details for d1ni2a2

PDB Entry: 1ni2 (more details), 2.3 Å

PDB Description: structure of the active ferm domain of ezrin

SCOP Domain Sequences for d1ni2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni2a2 b.55.1.5 (A:199-297) Ezrin {Human (Homo sapiens)}
emyginyfeiknkkgtdlwlgvdalglniyekddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilqlcmgnhelymrrrkp

SCOP Domain Coordinates for d1ni2a2:

Click to download the PDB-style file with coordinates for d1ni2a2.
(The format of our PDB-style files is described here.)

Timeline for d1ni2a2: