Class a: All alpha proteins [46456] (202 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (1 family) |
Family a.11.2.1: Second domain of FERM [47032] (6 proteins) |
Protein Ezrin [81714] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [81715] (1 PDB entry) |
Domain d1ni2a1: 1ni2 A:88-198 [80525] Other proteins in same PDB: d1ni2a2, d1ni2a3, d1ni2b2, d1ni2b3 |
PDB Entry: 1ni2 (more details), 2.3 Å
SCOP Domain Sequences for d1ni2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ni2a1 a.11.2.1 (A:88-198) Ezrin {Human (Homo sapiens)} dvaeeliqditqklfflqvkegilsdeiycppetavllgsyavqakfgdynkevhksgyl sserlipqrvmdqhkltrdqwedriqvwhaehrgmlkdnamleylkiaqdl
Timeline for d1ni2a1: