Lineage for d1ni0c_ (1ni0 C:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316351Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 316352Superfamily c.52.1: Restriction endonuclease-like [52980] (20 families) (S)
  5. 316439Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)
  6. 316440Protein Restriction endonuclease PvuII [52997] (1 species)
  7. 316441Species Proteus vulgaris [TaxId:585] [52998] (8 PDB entries)
  8. 316454Domain d1ni0c_: 1ni0 C: [80524]
    mutant

Details for d1ni0c_

PDB Entry: 1ni0 (more details), 2.5 Å

PDB Description: structure of the y94f mutant of the restriction endonuclease pvuii

SCOP Domain Sequences for d1ni0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni0c_ c.52.1.6 (C:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakfrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiyaa

SCOP Domain Coordinates for d1ni0c_:

Click to download the PDB-style file with coordinates for d1ni0c_.
(The format of our PDB-style files is described here.)

Timeline for d1ni0c_: