SCOP 1.67: Domain d1ni0b_: 1ni0 B:

Lineage for d1ni0b_ (1ni0 B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (22 families)

5. Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)

6. Protein Restriction endonuclease PvuII [52997] (1 species)

7. Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)

8. Domain d1ni0b_: 1ni0 B: [80523]

Details for d1ni0b_

PDB Entry: 1ni0, 2.5 Å

PDB Description: structure of the y94f mutant of the restriction endonuclease pvuii

SCOP Domain Sequences for d1ni0b_:

Sequence; same for both SEQRES and ATOM records:

>d1ni0b_ c.52.1.6 (B:) Restriction endonuclease PvuII {Proteus vulgaris}
hpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavdn
agqeyelksinidltkgfsthhhmnpviiakfrqvpwifaiyrgiaieaiyrlepkdlef
yydkwerkwysdghkdinnpkipvkyvmehgtkiyaa

Timeline for d1ni0b_:

• d1ni0b_ first appeared in SCOP 1.63
  
• d1ni0b_ appears in SCOP 1.65
  
• d1ni0b_ appears in SCOP 1.69
  
• d1ni0b_ appears in the current release, SCOPe 2.08, called d1ni0b1