Lineage for d1ni0a_ (1ni0 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604195Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1604196Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1604300Family c.52.1.6: Restriction endonuclease PvuII [52996] (2 proteins)
    automatically mapped to Pfam PF09225
  6. 1604301Protein Restriction endonuclease PvuII [52997] (1 species)
  7. 1604302Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)
  8. 1604319Domain d1ni0a_: 1ni0 A: [80522]
    mutant

Details for d1ni0a_

PDB Entry: 1ni0 (more details), 2.5 Å

PDB Description: structure of the y94f mutant of the restriction endonuclease pvuii
PDB Compounds: (A:) type II restriction enzyme pvuii

SCOPe Domain Sequences for d1ni0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni0a_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
hpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavdn
agqeyelksinidltkgfsthhhmnpviiakfrqvpwifaiyrgiaieaiyrlepkdlef
yydkwerkwysdghkdinnpkipvkyvmehgtkiyaa

SCOPe Domain Coordinates for d1ni0a_:

Click to download the PDB-style file with coordinates for d1ni0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ni0a_: