SCOP 1.67: Domain d1nhya2: 1nhy A:1-75

Lineage for d1nhya2 (1nhy A:1-75)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein GST-like domain of elongation factor 1-gamma [82428] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82429] (1 PDB entry)

8. Domain d1nhya2: 1nhy A:1-75 [80521]
   Other proteins in same PDB: d1nhya1
   complexed with mse, so4

Details for d1nhya2

PDB Entry: 1nhy, 3 Å

PDB Description: crystal structure of the gst-like domain of elongation factor 1-gamma from saccharomyces cerevisiae.

SCOP Domain Sequences for d1nhya2:

Sequence; same for both SEQRES and ATOM records:

>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae)}
msqgtlyanfrirtwvprglvkalkldvkvvtpdaaaeqfardfplkkvpafvgpkgykl
teamainyylvklsq

Timeline for d1nhya2:

• d1nhya2 first appeared in SCOP 1.63
  
• d1nhya2 appears in SCOP 1.65
  
• d1nhya2 appears in SCOP 1.69
  
• d1nhya2 appears in the current release, SCOPe 2.08