Lineage for d1nhed_ (1nhe D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 491356Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 491357Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) (S)
  5. 491366Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (1 protein)
  6. 491367Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 491368Species Cow (Bos taurus) [TaxId:9913] [53454] (13 PDB entries)
  8. 491387Domain d1nhed_: 1nhe D: [80515]
    Other proteins in same PDB: d1nhea_, d1nhec_

Details for d1nhed_

PDB Entry: 1nhe (more details), 2.5 Å

PDB Description: Crystal structure of Lactose synthase complex with UDP

SCOP Domain Sequences for d1nhed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhed_ c.68.1.2 (D:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus)}
ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
ywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketm
lsdglnsltymvlevqryplytkitvdigtps

SCOP Domain Coordinates for d1nhed_:

Click to download the PDB-style file with coordinates for d1nhed_.
(The format of our PDB-style files is described here.)

Timeline for d1nhed_: