Lineage for d1nhed_ (1nhe D:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 248321Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 248322Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (12 families) (S)
  5. 248331Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (1 protein)
  6. 248332Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 248333Species Cow (Bos taurus) [TaxId:9913] [53454] (11 PDB entries)
  8. 248349Domain d1nhed_: 1nhe D: [80515]
    Other proteins in same PDB: d1nhea_, d1nhec_
    complexed with ca, mse, pg4, udp

Details for d1nhed_

PDB Entry: 1nhe (more details), 2.5 Å

PDB Description: Crystal structure of Lactose synthase complex with UDP

SCOP Domain Sequences for d1nhed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhed_ c.68.1.2 (D:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus)}
ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
ywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketm
lsdglnsltymvlevqryplytkitvdigtps

SCOP Domain Coordinates for d1nhed_:

Click to download the PDB-style file with coordinates for d1nhed_.
(The format of our PDB-style files is described here.)

Timeline for d1nhed_: