Lineage for d1nhea_ (1nhe A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 251966Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 251967Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 251976Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 251977Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 252009Species Mouse (Mus musculus) [TaxId:10090] [69628] (8 PDB entries)
  8. 252024Domain d1nhea_: 1nhe A: [80512]
    Other proteins in same PDB: d1nheb_, d1nhed_

Details for d1nhea_

PDB Entry: 1nhe (more details), 2.5 Å

PDB Description: Crystal structure of Lactose synthase complex with UDP

SCOP Domain Sequences for d1nhea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhea_ d.2.1.2 (A:) alpha-Lactalbumin {Mouse (Mus musculus)}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

SCOP Domain Coordinates for d1nhea_:

Click to download the PDB-style file with coordinates for d1nhea_.
(The format of our PDB-style files is described here.)

Timeline for d1nhea_: